SLC25A19, menselijk (Cell-Free, zijn)

SLC25A19, a pivotal mitochondrial transporter, facilitates thiamine diphosphate uptake into mitochondria. While the specifics of its antiporter activity regarding the influence of membrane potential or proton electrochemical gradient remain unclear, SLC25A19's role as a transporter underscores its importance in mitochondrial processes, particularly the transport of thiamine diphosphate, a vital coenzyme in various metabolic pathways. SLC25A19 Protein, Human (Cell-Free, His) is the recombinant human-derived SLC25A19 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

SLC25A19 Protein, Human (Cell-Free, His), Human, E. coli Cell-free

12352202

MVGYDPKPDGRNNTKFQVAVAGSVSGLVTRALISPFDVIKIRFQLQHERLSRSDPSAKYHGILQASRQILQEEGPTAFWKGHVPAQILSIGYGAVQFLSFEMLTELVHRGSVYDAREFSVHFVCGGLAACMATLTVHPVDVLRTRFAAQGEPKVYNTLRHAVGTMYRSEGPQVFYKGLAPTLIAIFPYAGLQFSCYSSLKHLYKWAIPAEGKKNENLQNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEGALGFFKGLSPSLLKAALSTGFMFFSYEFFCNVFHCMNRTASQR

60386 (Gene_ID) Q9HC21 (M1-R320) (Accession)

Room temperature in continental US; may vary elsewhere.

Recombinant Proteins