SLC5A12 Rabbit pAb (APR22768N)

Normal blood lactate is maintained at about 1.5 mM, and little filtered lactate is excreted in urine. Reabsorption of lactate is mediated by the low-affinity Na (+) -coupled lactate transporter SLC5A12 in the initial part of the proximal tubule and by the high-affinity Na (+) -coupled lactate transporter SLC5A8 (MIM 608044) in the distal proximal tubule.

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SLC5A12 Rabbit pAb (APR22760N7) .

SLC5A12; SMCT2

159963

Q1EHB4

Apical cell membrane, Multi-pass membrane protein

WB 1:500 - 1:2000

Liquid

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Calculated MW: 44kDa/67kDa Observed MW: 67kDa

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=159963

https://www.uniprot.org/uniprot/Q1EHB4

LIQGSTHAGGFHNVLEQSTNGSRLHIFDFDVDPLRRHTFWTITVGGTFTWLGIYGVNQSTIQRCISCKTEKHAKLALYFNL