SLC5A6 Rabbit pAb (APR21365N)

Sodium-dependent multivitamin transporter that transports pantothenate, biotin and lipoate. Required for biotin and pantothenate uptake in the instestine (By similarity. Plays a role in the maintenance of intestinal mucosa integrity, by providing the gut mucosa with biotin (By similarity. May play a role in the transport of biotin and pantothenate into the brain across the blood-brain barrier. May also be involved in the sodium-dependent transport of iodide ions.

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SLC5A6 Rabbit pAb (APR21365N) .

SLC5A6; SMVT

8884

Q9Y289

Membrane, Multi-pass membrane protein

IHC 1:50 - 1:200

Liquid

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Calculated MW: 68kDa

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8884

https://www.uniprot.org/uniprot/Q9Y289

TVATVTTLMPLTTFSKPTGLQRFYSLSYLWYSAHNSTTVIVVGLIVSLLTGRMRGRSLNPATIYPVLPKLLSLLPLSCQKRLHCRSYGQDHLDTGLFPEKPRNGVLGDSRDKEAMALDGTAYQGSSSTCILQETSL