SLC7A5 Rabbit pAb (APR24972N)

The heterodimer with SLC3A2 functions as sodium-independent, high-affinity transporter that mediates uptake of large neutral amino acids such as phenylalanine, tyrosine, L-DOPA, leucine, histidine, methionine and tryptophan. Functions as an amino acid exchanger. May play a role in the transport of L-DOPA across the blood-brain barrier (By similarity. May act as the major transporter of tyrosine in fibroblasts (Probable. May mediate blood-to-retina L-leucine transport across the inner blood-retinal barrier (By similarity. Can mediate the transport of thyroid hormones triiodothyronine (T3 and thyroxine (T4 across the cell membrane. When associated with LAPTM4B, the heterodimer formed by SLC3A2 and SLC7A5 is recruited to lysosomes to promote leucine uptake into these organelles, and thereby mediates mTORC1 activation. Involved in the uptake of toxic methylmercury (MeHg when administered as the L-cysteine or D, L-homocysteine complexes. Involved in the cellular activity of small molecular weight nitrosothiols, via the stereoselective transport of L-nitrosocysteine (L-CNSO across the membrane.

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SLC7A5 Rabbit pAb (APR24972N) .

SLC7A5; 4F2LC; CD98; D16S469E; E16; LAT1; MPE16; hLAT1

8140

Q01650

Apical cell membrane, Cytoplasm, Multi-pass membrane protein, cytosol

WB (Sus scrofa)

WB 1:500 - 1:1000 IF 1:50 - 1:200

Liquid

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Calculated MW: 55kDa Observed MW: 45KDa

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8140

https://www.uniprot.org/uniprot/Q01650

MAGAGPKRRALAAPAAEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNITLLNGVAIIVGTIIGSGIFVTPTGVLKEAGSPGLALVVWAACGVFSIVGALCYAELGTTISKSGGDYAYMLEVYG