SLC8A1 Antilichaam - N-terminaal gebied: Biotine (ARP44018_P050-Biotine)

Solute carrier family 8 (sodium/calcium exchanger), member 1

NCX1

6546

P32418

NP_001106271.1

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

The immunogen is a synthetic peptide directed towards the N-terminal region of human SLC8A1

In cardiac myocytes, Ca (2+) concentrations alternate between high levels during contraction and low levels during relaxation. The increase in Ca (2+) concentration during contraction is primarily due to release of Ca (2+) from intracellular stores. However, some Ca (2+) also enters the cell through the sarcolemma (plasma membrane) . During relaxation, Ca (2+) is sequestered within the intracellular stores. To prevent overloading of intracellular stores, the Ca (2+) that entered across the sarcolemma must be extruded from the cell. The Na (+) -Ca (2+) exchanger is the primary mechanism by which the Ca (2+) is extruded from the cell during relaxation. In the heart, the exchanger may play a key role in digitalis action. The exchanger is the dominant mechanism in returning the cardiac myocyte to its resting state following excitation.[supplied by OMIM, Apr 2004]

Biotin

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 83%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

73kDa

Wet Ice

664

SLC8A1

SLC8A1

Rabbit

Sodium/calcium exchanger 1

NM_001112800.1

CTGSYYCKKGVILPIWEPQDPSFGDKIARATVYFVAMVYMFLGVSIIADR