SLUG Antilichaam / SNAI2

SLUG is also known as SNAI2. This gene encodes a member of the Snail family of C2H2-type zinc finger transcription factors. The encoded protein acts as a transcriptional repressor that binds to E-box motifs and is also likely to repress E-cadherin transcription in breast carcinoma. This protein is involved in epithelial-mesenchymal transitions and has antiapoptotic activity. Mutations in this gene may be associated with sporatic cases of neural tube defects.

Western blot: 0.5-1 µg/mL, Immunohistochemistry (FFPE) : 2-5 µg/mL

O43623

Human, Mouse, Rat

Amino acids KLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQ of human SLUG were used as the immunogen for the SLUG antibody.

WB, IHC-P

Antigen affinity

Antigen affinity purified

Lyophilized from 1X PBS with 2% Trehalose

This SLUG antibody is available for research use only.

After reconstitution, the SLUG antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Optimal dilution of the SLUG antibody should be determined by the researcher.

IHC staining of FFPE rat colon tissue with SLUG antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.