SMARCAL1 Antilichaam - C-terminaal gebied : HRP (ARP39056 T100-HRP)

SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a-like 1

HARP, HHARP

50485

Q9NZC9

NP_054859

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

The immunogen is a synthetic peptide directed towards the C terminal region of human SMARCAL1

SMARCAL1 is a member of the SWI/SNF family of proteins. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. Mutations in SMARCAL1 gene are a cause of Schimke immunoosseous dysplasia (SIOD), an autosomal recessive disorder with the diagnostic features of spondyloepiphyseal dysplasia, renal dysfunction, and T-cell immunodeficiency.The protein encoded by this gene is a member of the SWI/SNF family of proteins. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein shows sequence similarity to the E. coli RNA polymerase-binding protein HepA. Mutations in this gene are a cause of Schimke immunoosseous dysplasia (SIOD), an autosomal recessive disorder with the diagnostic features of spondyloepiphyseal dysplasia, renal dysfunction, and T-cell immunodeficiency.

UBC; RPA3; RPA2; RPA1; SULT1A1; Cebpb

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

SMARCAL1 is supported by BioGPS gene expression data to be expressed in 721_B

0.5 mg/ml

Cow: 92%; Dog: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 100%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

106kDa

Clewing, J.M., (2007) Hum. Mutat. 28 (3), 273-283

Wet Ice

954

SMARCAL1

SMARCAL1

Rabbit

SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1

NM_014140

EAAESFDPGSASGTSGSSSQNMGDTLDESSLTASPQKKRRFEFFDNWDSF