SMARCB1 Antilichaam - N-terminalgebied: FITC (ARP38220 P050-FITC)

SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1

RDT, CSS3, INI1, SNF5, Snr1, BAF47, MRD15, RTPS1, Sfh1p, hSNFS, SNF5L1, SWNTS1, PPP1R144

6598

Q12824

NP_001007469.1

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Zebrafish

The immunogen is a synthetic peptide directed towards the N-terminal region of human SMARCB1

The protein encoded by this gene is part of a complex that relieves repressive chromatin structures, allowing the transcriptional machinery to access its targets more effectively. The encoded nuclear protein may also bind to and enhance the DNA joining activity of HIV-1 integrase. This gene has been found to be a tumor suppressor, and mutations in it have been associated with malignant rhabdoid tumors. Alternatively spliced transcript variants have been found for this gene.

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 86%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

37kDa

Wet Ice

339

SMARCB1

SMARCB1

Rabbit

SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1

NM_001007468.1

MMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWR