SOX1 Antilichaam - middengebied: HRP (ARP38720_P050-HRP)

SRY (sex determining region Y) -box 1

6656

O00570

NP_005977

Human, Mouse, Cow, Dog, Guinea Pig, Rabbit, Zebrafish

The immunogen is a synthetic peptide directed towards the middle region of human SOX1

SOX1 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. SOX1 may act as a transcriptional activator after forming a protein complex with other proteins. In mice, a similar protein regulates the gamma-crystallin genes and is essential for lens development.This intronless gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional activator after forming a protein complex with other proteins. In mice, a similar protein regulates the gamma-crystallin genes and is essential for lens development.

CTNNB1

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 93%; Dog: 100%; Guinea Pig: 79%; Human: 100%; Mouse: 100%; Rabbit: 100%; Zebrafish: 92%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

39kDa

Sabater, L., (2008) Neurology 70 (12), 924-928

Wet Ice

391

SOX1

SOX1

Rabbit

Transcription factor SOX-1

NM_005986

REMISMYLPAGEGGDPAAAAAAAAQSRLHSLPQHYQGAGAGVNGTVPLTH