SOX13 Antilichaam - middengebied HRP (ARP58143_P050-HRP)

SRY (sex determining region Y) -box 13

ICA12, Sox-13

9580

Q3KQV7

NP_005677

Human, Mouse, Rat, Dog, Guinea Pig, Horse

The immunogen is a synthetic peptide directed towards the middle region of human SOX13

SOX13 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. It has also been determined to be a type-1 diabetes autoantigen, also known as islet cell antibody 12. This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. It has also been determined to be a type-1 diabetes autoantigen, also known as islet cell antibody 12. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

YTHDC1; SMAD7; CTBP2; SOX13

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Dog: 85%; Guinea Pig: 100%; Horse: 85%; Human: 100%; Mouse: 85%; Rat: 92%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

69kDa

Park, Y., Ann. N. Y. Acad. Sci. 1005, 253-258 (2003)

Wet Ice

622

SOX13

SOX13

Rabbit

Transcription factor SOX-13

NM_005686

TARYCGSFCQHKDWEKHHHICGQTLQAQQQGDTPAVSSSVTPNSGAGSPM