SSX7 Antilichaam - middengebied: Biotine (ARP51717_P050-Biotine)

Synovial sarcoma, X breakpoint 7

280658

Q7RTT5

NP_775494

Human

The immunogen is a synthetic peptide directed towards the middle region of human SSX7

SSX7 belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t (X;18) translocation characteristically found in all synovial sarcomas. This gene appears not to be involved in this type of chromosome translocation.The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t (X;18) translocation characteristically found in all synovial sarcomas. This gene appears not to be involved in this type of chromosome translocation.

Biotin

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Human: 100%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

21kDa

Ross, M.T., (2005) Nature 434 (7031), 325-337

Wet Ice

188

SSX7

SSX7

Rabbit

Protein SSX7

NM_173358

IFPKIMPKKPAEEGNDSKGVPEASGSQNDGKHLCPPGKPSTSEKINKTSG