Staphylokinase

Staphylococcal kinase protein is a potent plasminogen activator that converts plasminogen into active plasmin. In addition to activation, staphylococcal kinase forms a 1:1 complex with plasmin, enabling activated plasmin to catalyze the conversion of other plasminogen molecules. Staphylokinase Protein, Staphylococcus phage (His) is the recombinant mouse-derived Staphylokinase protein, expressed by E. coli , with N-6*His labeled tag. The total length of Staphylokinase Protein, Staphylococcus phage (His) is 136 a.a., with molecular weight of ~17 kDa.

Staphylokinase Protein, Staphylococcus phage (His), Others, E. coli

12352202

98.0

SSSFDKGKYKKGDDASYFEPTGPYLMVNVTGVDGKRNELLSPRYVEFPIKPGTTLTKEKIEYYVEWALDATAYKEFRVVELDPSAKIEVTYYDKNKKKEETKSFPITEKGFVVPDLSEHIKNPGFNLITKVVIEKK

/ (Gene_ID) P15240 (S28-K163) (Accession)

Approximately 18 kDa

Room temperature in continental US; may vary elsewhere.

Stored at -20°C for 2 years

Recombinant Proteins