Streptokinase G, Streptococcus sp. (Hij)

Streptokinase G protein, devoid of protease activity, complexes with plasminogen, inducing its activation. Serving as a potential virulence factor, Streptokinase G is implicated in hindering robust fibrin barriers at infection sites, potentially augmenting microbial pathogenicity. Its activation of plasminogen highlights its role in manipulating the host's fibrinolytic system—a strategy employed to evade defenses and enhance infection. Streptokinase G Protein, Streptococcus sp. (His) is the recombinant Streptokinase G protein, expressed by E. coli , with N-6*His labeled tag.

Streptokinase G Protein, Streptococcus sp. (His), Others, E. coli

12352202

98.00

IAGPEWLLDRPSVNNSQLVVSVAGTVEGTNQDISLKFFEIDLTSRPAHGGKTEQGLSPKSKLFATDSGAMPHKLEKADLLKAIQEQLIANVHSNDDYFEVIDFASDATITDRNGKVYFADKDGSVTLPIQPVQEFLLKGHVRVRPYKEKPVQNQAKSVDVEYTVQFTPLNPDDDFRPALKDTKLLKTLAIGDTITSQELLAQAQSILNKNHPGYTIYERDSSIVTHDNDIFRTILPMDQEFTYHVKNREQAYRINKKSGLNEEINNTDLISEKYYVLKKGEKPYDPFDRSHLKLFTIKYVDVNTNELLKSEQLLTASERNLDFRDLYDPRDKAKLLYNNLDAFGIMDYTLTGKVEDNHDDTNRIITVYMGKRPEGENASYHLAYDKDRYTEEEREVYSYLRYTGTPIPDNPNDK

/ (Gene_ID) P10519 (I27-K440) (Accession)

Predict MW: 48.16 kDa; Approximately 50 kDa

Room temperature in continental US; may vary elsewhere.

Stored at -20°C for 2 years

Recombinant Proteins