Sumo3 Antilichaam - N-terminalgebied: FITC (ARP45841 P050-FITC)

SMT3 suppressor of mif two 3 homolog 3 (yeast)

SMT, SMT3A, Smt3h, SUMO-3, Smt3h1, D10Ertd345, D10Ertd345e, 2810014B19Rik

20610

Q9Z172

NP_064313

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

The immunogen is a synthetic peptide directed towards the N-terminal region of Sumo3

Sumo3 is a ubiquitin-like protein which can be covalently attached to target lysines either as a monomer or as a lysine-linked polymer. It does not seem to be involved in protein degradation and may function as an antagonist of ubiquitin in the degradation process. It plays a role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Covalent attachment to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by an E3 ligase such as PIAS1-4, RANBP2 or CBX4.

Ep300; Senp6; Ikbkg; Npm1; Mdm2; Uimc1; Mafg

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

12kDa

Wet Ice

110

SUMO3

Sumo3

Rabbit

Small ubiquitin-related modifier 3

NM_019929

PKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMR