SUV39H1 Antilichaam - C-terminalgebied: FITC (ARP32470_T100-FITC)

Suppressor of variegation 3-9 homolog 1 (Drosophila)

MG44, KMT1A, SUV39H, H3-K9-HMTase 1

6839

O43463

NP_003164

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Zebrafish

The immunogen is a synthetic peptide directed towards the C terminal region of human SUV39H1

SUV39H1, a human homolog of the Drosophila position effect variegation modifier Su (var) 3-9 and of the S. pombe silencing factor clr4, encodes a heterochromatic protein that transiently accumulates at centromeric positions during mitosis.This gene is a member of the suppressor of variegation 3-9 homolog family and encodes a protein with a chromodomain and a C-terminal SET domain. This nuclear protein moves to the centromeres during mitosis and functions as a histone methyltransferase, methylating Lys-9 of histone H3. Overall, it plays a vital role in heterochromatin organization, chromosome segregation, and mitotic progression. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

LZTS2; CEP70; HOOK2; CBX5; KRTAP10-7; HIST2H3A; CDCA4; KLHDC4; GTPBP2; ZNF581; ZCCHC17; CRBN; ING4; DCAF8; KLF15; KLHL20; PHF19; IL16; IGFBP4; ID2; ID1; HOXC4; HOXA1; FYN; FUS; EZH2; CLK3; ATP6V1B1; ATF3; GTF2H2C_2; H3F3C; LHX8; STX19; C17orf82; ZNF829; C

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

IHC, WB

SUV39H1 is supported by BioGPS gene expression data to be expressed in HepG2

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

48kDa

Frontelo, P., et al., (2004) Oncogene 23 (30), 5242-5251

Wet Ice

412

SUV39H1

SUV39H1

Rabbit

Histone-lysine N-methyltransferase SUV39H1

NM_003173

FDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCRKYLF