Synaptofysin Rabbit pAb (APR26443N)

This gene encodes an integral membrane protein of small synaptic vesicles in brain and endocrine cells. The protein also binds cholesterol and is thought to direct targeting of vesicle-associated membrane protein 2 (synaptobrevin) to intracellular compartments. Mutations in this gene are associated with X-linked mental retardation (XLMR) .

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Synaptophysin Rabbit pAb (APR26443N) .

MRX96; MRXSYP; SYP

6855

P08247

Cell junction, Cytoplasmic vesicle, Multi-pass membrane protein, secretory vesicle, synapse, synaptic vesicle membrane, synaptosome

IF (Mouse tibialis anterior muscle) WB (Mus musculus, Rattus norvegicus) IHC (Rattus norvegicus)

WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:200 IP 1:50 - 1:200

Liquid

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Calculated MW: 20kDa/33kDa Observed MW: 38KDa

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6855

https://www.uniprot.org/uniprot/P08247

AFMWLVSSSAWAKGLSDVKMATDPENIIKEMPVCRQTGNTCKELRDPVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFLRAPPGAPEKQPAPGDAY