Tau (K18) wilde monomeren

Tauopathies are a class of neurodegenerative diseases characterized by the pathological aggregation of tau protein into insoluble fibrils that disrupt neuronal function. The K18 fragment, which includes the four microtubule-binding repeat domains of tau, is frequently used in experimental models due to its propensity to form fibrillar aggregates. This fragment retains key aggregation-prone hexapeptide motifs that drive β-sheet formation and fibrillization. StressMarq’s Human Recombinant Tau (K18) Wild-Type Monomers have been demonstrated to form fibrils in the presence of heparin or when seeded with fibrils.

Human Recombinant Tau (K18) Wild-Type Monomers

Tau, Microtubule-associated Tau, Microtubule-associated protein Tau, MAPT, MAP, Tau-441, Tau-412, Tau-381, Tau-352, Paired Helical Filament-Tau, PHF-Tau, Neurofibrillary Tangle Tau, G Beta/Gamma Subunit-Interacting Factor 1, Isoform 4, Tubulin-associated unit

12352202

Non-hazardous

Non-hazardous

P10636

E. coli

No Tag

Recombinant

WB | SDS-PAGE | In vivo assay | In vitro assay

Neuroscience | Neurodegeneration | Alzheimer's Disease | Tangles & Tau

Ion-exchange Purified

Certified > 95% pure via SDS-PAGE and A260/A280 ratio

2 mg/ml

> 95%

10 mM HEPES pH 7.4, 100 mM NaCl

15.18 kDa

Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.

Dry Ice. Shipping note: Product will be shipped separately from other products purchased in the same order.

-80ºC

Product is wildtype equivalent of SPR-328. Corresponding fibril is SPR-525.

141 amino acids

Boyarko, B., & Hook, V. (2021) . Human tau isoforms and proteolysis for production of toxic tau fragments in neurodegeneration. Frontiers in Neuroscience, 15, 702788. https://doi.org/10.3389/fnins.2021.702788 Zeng, Y., Yang, J., Zhang, B., Gao, M., Su, Z., & Huang, Y. (2020) . The structure and phase of tau: From monomer to amyloid filament. Cellular and Molecular Life Sciences, 78, 1873–1886. https://doi.org/10.1007/s00018-020-03681-x Zhang, X., Wang, J., Zhang, Z., & Ye, K. (2024) . Tau in neurodegenerative diseases: Molecular mechanisms, biomarkers, and therapeutic strategies. Translational Neurodegeneration, 13 (40) . https://doi.org/10.1186/s40035-024-00429-6

MSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLKDFDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRE

Human