Tau (K18) Wildtype voorgevormde fibrillen

Tauopathies are a class of neurodegenerative diseases characterized by the pathological aggregation of tau protein into insoluble fibrils that disrupt neuronal function. The K18 fragment, which includes the four microtubule-binding repeat domains of tau, is frequently used in experimental models due to its propensity to form fibrillar aggregates. Kumar & Udgaonkar (2022) observed that tau K18 wildtype fibrils exhibit distinct structural features compared to mutant forms, with the wildtype fibrils catalyzing aggregation of monomeric tau more efficiently. StressMarq’s Human Recombinant Tau (K18) Wild-Type Pre-Formed Fibrils have been demonstrated to seed monomers in an in-vitro ThT seeding assay.

Human Recombinant Tau (K18) Wild-Type PFFs

Tau, Microtubule-associated Tau, Microtubule-associated protein Tau, MAPT, MAP, Tau-441, Tau-412, Tau-381, Tau-352, Paired Helical Filament-Tau, PHF-Tau, Neurofibrillary Tangle Tau, G Beta/Gamma Subunit-Interacting Factor 1, Isoform 4, Tubulin-associated unit

12352202

Non-hazardous

Non-hazardous

P10636

E. coli

No Tag

Recombinant

WB | SDS-PAGE | In vivo assay | In vitro assay

Neuroscience | Neurodegeneration | Alzheimer's Disease | Tangles & Tau

Ion-exchange Purified

Certified > 95% pure via SDS-PAGE and A260/A280 ratio

2 mg/ml

> 95%

10 mM HEPES pH 7.4, 100 mM NaCl

15.18 kDa

Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.

Dry Ice. Shipping note: Product will be shipped separately from other products purchased in the same order.

-80ºC

Product is wildtype equivalent of Catalog No. SPR-330. Corresponding monomer is SPR-524.

141 amino acids

Boyarko, B., & Hook, V. (2021) . Human tau isoforms and proteolysis for production of toxic tau fragments in neurodegeneration. Frontiers in Neuroscience, 15, 702788. https://doi.org/10.3389/fnins.2021.702788 Kumar, H., & Udgaonkar, J. B. (2022) . Elongation of fibrils formed by a tau fragment is inhibited by a transient dimeric intermediate. The Journal of Physical Chemistry B, 126 (18), 3385–3397. https://doi.org/10.1021/acs.jpcb.1c10752 Zeng, Y., Yang, J., Zhang, B., Gao, M., Su, Z., & Huang, Y. (2020) . The structure and phase of tau: From monomer to amyloid filament. Cellular and Molecular Life Sciences, 78, 1873–1886. https://doi.org/10.1007/s00018-020-03681-x Zhang, X., Wang, J., Zhang, Z., & Ye, K. (2024) . Tau in neurodegenerative diseases: Molecular mechanisms, biomarkers, and therapeutic strategies. Translational Neurodegeneration, 13 (40) . https://doi.org/10.1186/s40035-024-00429-6

MSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLKDFDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRE

Human