TBX21 Antilichaam - C-terminaal gebied: Biotine (ARP37251 T100-Biotine)

T-box 21

TBT1, Tbet, Tbly, Tblym

57765

Q9JKD8

NP_062380

Human, Mouse, Rat, Cow, Dog, Pig, Rabbit, Sheep

The immunogen is a synthetic peptide directed towards the C terminal region of mouse TBX21

TBX21 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. It is the human ortholog of mouse Tbx21/Tbet gene. Studies in mouse show that Tbx21 protein is a Th1 cell-specific transcription factor that controls the expression of the hallmark Th1 cytokine, interferon-gamma (IFNG) . Expression of the human ortholog also correlates with IFNG expression in Th1 and natural killer cells, suggesting a role for this gene in initiating Th1 lineage development from naive Th precursor cells.

Bcl6; Smarca4; Tlx3; Tead4; Pax9; Gsc; Gata3; Dlx1; Alx4; Rbpj; Stat1; Ifng; Tec; Itk; Txk

Biotin

Polyclonal Antibody

WB

0.5 mg/ml

Cow: 86%; Dog: 86%; Human: 93%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 93%; Sheep: 86%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

58kDa

Hirata, T., et al., (2006) Development 133 (8), 1433-1443

Wet Ice

530

TBX21

TBX21

Rabbit

T-box transcription factor TBX21

NM_019507

MDPGLGSSEEQGSSPSLWPEVTSLQPESSDSGLGEGDTKRRRISPYPSSG