TCF3 Antilichaam - N-terminalgebied: HRP (ARP38267_T100-HRP)

Transcription factor 3 (E2A immunoglobulin enhancer binding factors E12/E47)

E2A, E47, p75, AGM8, ITF1, VDIR, TCF-3, bHLHb21

6929

P15923

NP_003191

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit

The immunogen is a synthetic peptide directed towards the N terminal region of human TCF3

TCF3 contains 1 basic helix-loop-helix (bHLH) domain. Heterodimers between TCF3 and tissue-specific basic helix-loop-helix (bHLH) proteins play major roles in determining tissue-specific cell fate during embryogenesis, like muscle or early B-cell differentiation. Dimers bind DNA on E-box motifs: 5'-CANNTG-3'. TCF3 binds to the kappa-E2 site in the kappa immunoglobulin gene enhancer.

ID3; FAM115A; TLE1; RNF14; UBC; SCX; MAPKAPK2; MAPKAPK3; TCF21; Ube2i; ID2; FUS; CTNNB1; RPL37; MAX; USF1; TCF12; TCF3; MYOD1; Rufy1; Tfap4; Rpa1; Tbx6; Ncl; Twist2; SUPT3H; TRRAP; KAT2A; TADA2A; FOXH1; ELAVL1; TCF24; SETSIP; FLG2; BHLHA15; MYL6B; TIMM50

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

TCF3 is strongly supported by BioGPS gene expression data to be expressed in HepG2

0.5 mg/ml

Cow: 93%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 77%; Rat: 100%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

68kDa

Maruyama, K. (2005) J. Biol. Chem. 280 (41), 34577-34589

Wet Ice

654

TCF3

TCF3

Rabbit

Transcription factor E2-alpha

NM_003200

MNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRPASLAGAQFGGSGL