Tdp1 Antilichaam - middengebied: Biotine (ARP57199_P050-Biotine)

Tyrosyl-DNA phosphodiesterase 1

SC, SCAN1, Gm40556, MLZ-501, AI838772, AW493413, 2810481F14Rik, 4921509N21Rik, E430034L06Rik

104884

NP_082630

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

The immunogen is a synthetic peptide corresponding to a region of Mouse

Tdp1 is a DNA repair enzyme that can remove a variety of covalent adducts from DNA through hydrolysis of a 3'-phosphodiester bond, giving rise to DNA with a free 3' phosphate. It catalyzes the hydrolysis of dead-end complexes between DNA and the topoisomerase I active site tyrosine residue. It hydrolyzes 3'-phosphoglycolates on protruding 3' ends on DNA double-strand breaks due to DNA damage by radiation and free radicals. It acts on blunt-ended double-strand DNA breaks and on single-stranded DNA. It has low 3'exonuclease activity and can remove a single nucleoside from the 3'end of DNA and RNA molecules with 3'hydroxyl groups. It has no exonuclease activity towards DNA or RNA with a 3'phosphate.

Biotin

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 92%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 100%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

64kDa

Wet Ice

579

TDP1

Tdp1

Rabbit

NM_028354

ETNVYLIGSTPGRFQGSHRDNWGHFRLRKLLQAHAPSTPKGECWPIVGQF