Testin, mens (zijn)

Testin protein is a scaffold protein that plays multiple roles in cell adhesion, spreading, and actin cytoskeleton reorganization. Testin is involved in the regulation of cell proliferation and acts as a tumor suppressor, inhibiting the growth of tumor cells. Testin Protein, Human (His) is the recombinant human-derived Testin, expressed by E. coli, with C-6*His labeled tag.

Testin Protein, Human (His), Human, E. coli

12352202

MDLENKVKKMGLGHEQGFGAPCLKCKEKCEGFELHFWRKICRNCKCGQEEHDVLLSNEEDRKVGKLFEDTKYTTLIAKLKSDGIPMYKRNVMILTNPVAAKKNVSINTVTYEWAPPVQNQALARQYMQMLPKEKQPVAGSEGAQYRKKQLAKQLPAHDQDPSKCHELSPREVKEMEQFVKKYKSEALGVGDVKLPCEMDAQGPKQMNIPGGDRSTPAAVGAMEDKSAEHKRTQYSCYCCKLSMKEGDPAIYAERAGYDKLWHPACFVCSTCHELLVDMIYFWKNEKLYCGRHYCDSEKPRCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDSILAGEIYVMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTYNNFSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSVECKKRMS

26136 (Gene_ID) Q9UGI8 (M1-S421) (Accession)

Approximately 50 kDa, based on SDS-PAGE under reducing conditions.

Dry ice.

Recombinant Proteins