Tetranucleïne/CLEC3B, menselijk (HEK293, zijn)

Tetranectin/CLEC3B protein exhibits binding to plasminogen and isolated kringle 4, suggesting potential roles in exocytosis-related molecule packaging and ocular physiology. Its homotrimeric structure emphasizes a propensity for trimeric complexes, highlighting the multifaceted nature of Tetranectin/CLEC3B in diverse molecular interactions and cellular processes. Tetranectin/CLEC3B Protein, Human (HEK293, His) is the recombinant human-derived Tetranectin/CLEC3B protein, expressed by HEK293 , with C-6*His labeled tag.

Tetranectin/CLEC3B Protein, Human (HEK293, His), Human, HEK293

12352202

98.0

EPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVCLKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLGTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIV

7123 (Gene_ID) AAH11024.1 (E22-V202) (Accession)

Approximately 20-24 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Room temperature in continental US; may vary elsewhere.

Stored at -20°C for 2 years

Recombinant Proteins