Tgfb1 Antilichaam - middengebied: FITC (ARP37156 T100-FITC)

Transforming growth factor, beta 1

Tgfb, Tgfb-1, TGFbeta, TGF-beta, TGFbeta1, TGF-beta1

21803

P01137

NP_035707

Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep

The immunogen is a synthetic peptide directed towards the middle region of mouse Tgfb1

Tgfb1 is a multifunctional protein that control proliferation, differentiation, and other functions in many cell types. Many cells synthesize TGFB1 and essentially all of them have specific receptors for this protein. It regulates the actions of many other growth factors and determines a positive or negative direction of their effects. It plays an important role in bone remodelling. It is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts.

Htra1; Nrep; Ltbp3; Col1a1; Tgfbr3; Tgfbr1; Tgfbr2; Smad4; Hdac3; Jun

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

0.5 mg/ml

Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

42kDa

Wet Ice

390

TGFB1

Tgfb1

Rabbit

Transforming growth factor beta-1

NM_011577

SRAELRLQRLKSSVEQHVELYQKYSNNSWRYLGNRLLTPTDTPEWLSFDV