TIGD3 Antilichaam - N-terminaal gebied: Biotine (ARP49033 T100-Biotine)

Tigger transposable element derived 3

220359

Q6B0B8

NP_663771

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

The immunogen is a synthetic peptide directed towards the N terminal region of human TIGD3

TIGD3 belongs to the tigger subfamily of the pogo superfamily of DNA-mediated transposons in humans. These proteins are related to DNA transposons found in fungi and nematodes, and more distantly to the Tc1 and mariner transposases. They are also very similar to the major mammalian centromere protein B. The exact function of TIGD3 gene is not known.The protein encoded by this gene belongs to the tigger subfamily of the pogo superfamily of DNA-mediated transposons in humans. These proteins are related to DNA transposons found in fungi and nematodes, and more distantly to the Tc1 and mariner transposases. They are also very similar to the major mammalian centromere protein B. The exact function of this gene is not known.

Biotin

Polyclonal Antibody

WB

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

52kDa

Gerhard, D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Wet Ice

471

TIGD3

TIGD3

Rabbit

Tigger transposable element-derived protein 3

NM_145719

NKEKLLADWCSGTANRERKRKRESKYSGIDEALLCWYHIARAKAWDVTGP