TMOD3 Antilichaam - middelste regio : HRP (ARP55078 P050-HRP)

Tropomodulin 3 (ubiquitous)

UTMOD

29766

Q9NYL9

NP_055362

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

The immunogen is a synthetic peptide directed towards the middle region of human TMOD3

TMOD3 belongs to the tropomodulin family. It blocks the elongation and depolymerization of the actin filaments at the pointed end. The Tmod/TM complex contributes to the formation of the short actin protofilament, which in turn defines the geometry of the membrane skeleton. This gene is a necessary element in receptor tyrosine kinase pathways, possibly as a tyrosine phosphorylation target. It is involved in regulation of RAF in the MAPK pathway and may also play a role in a MAPK-independent pathway.

UBC; PABPC1; YWHAE; PSMD9; PPP1CA; DHX15; PAN2; CSNK2A1; HNRNPUL2; PPIL3; AHCYL1; SULT1A1; PSMC4; PSMB7; NPC1; ATP6V1B1; LRRK2; FBXO25; ISG15; ARRB2; ARRB1; ELAVL1; SUMO2; DUSP23; TNFSF11; MAP1LC3B; Poc1b; Tubgcp3; Sass6; Trim69; Stag2; Pafah1b1; Erh; Cdk

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

39kDa

Weber, K.L., J. Cell. Sci. 120 (PT 20), 3625-3632 (2007)

Wet Ice

352

TMOD3

TMOD3

Rabbit

Tropomodulin-3

NM_014547

ITNTKFCNIMGSSNGVDQEHFSNVVKGEKILPVFDEPPNPTNVEESLKRT