TNF RII/TNFRSF1B, menselijk (183a)

The TNFRII protein is a receptor with high affinity for TNFSF2/TNF-α and low affinity for TNFSF1/lymphotoxin-α, and plays a key role in mediating the metabolic effects of TNF-α. The TRAF1/TRAF2 complex recruits BIRC2 and BIRC3 to TNFRSF1B/TNFR2 to regulate the apoptotic pathway. TNFRII Protein, Human (183a.a) is the recombinant human-derived TNFRII protein, expressed by E. coli , with tag free.

TNF RII/TNFRSF1B Protein, Human (183a.a), Human, E. coli

12352202

97.00

PAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPT

7133 (Gene_ID) P20333-1 (P24-T206) (Accession)

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

Room temperature in continental US; may vary elsewhere.

Stored at -20°C for 2 years

Recombinant Proteins