TNS4 Rabbit pAb (APR28420N)

May be involved in cell migration, cartilage development and in linking signal transduction pathways to the cytoskeleton (By similarity. May promote apoptosis, via its cleavage by caspase-3.

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TNS4 Rabbit pAb (APR28420N) .

TNS4; CTEN; PP14434; tensin-4

84951

Q8IZW8

Cell junction, Cytoplasm, cytoskeleton, focal adhesion

WB 1:500 - 1:2000

Liquid

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Calculated MW: 76kDa Observed MW: 77kDa

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=84951

https://www.uniprot.org/uniprot/Q8IZW8

CPEPGSSPPQRTPGHQNSVQPGAASPSNPCPATRSNSQTLSDAPFTTCPEGPARDMQPTMKFVMDTSKYWFKPNITREQAIELLRKEEPGAFVIRDSSSYRGSFGLALKVQEVPASAQSRPGEDSNDLIRHFLIESSAKGV