TOM20 Konijn pAb (APR26837N)

Central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with TOM22 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the TOM40 translocation pore (By similarity. Required for the translocation across the mitochondrial outer membrane of cytochrome P450 monooxygenases.

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TOM20 Rabbit pAb (APR26837N) .

TOMM20; MAS20; MOM19; TOM20

9804

Q15388

Mitochondrion outer membrane, Single-pass membrane protein

IF (Mouse brown fat cells, Rattus norvegicus, Mus musculus) IHC (Mus musculus) WB (Homo sapiens, Mus musculus, Rattus norvegicus)

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:20 - 1:50 IP 1:50 - 1:200

Liquid

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Calculated MW: 16kDa Observed MW: 16KDa

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9804

https://www.uniprot.org/uniprot/Q15388

YCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE