TP53INP1 Antilichaam - C-terminaal gebied: HRP (ARP30636 P050-HRP)

Tumor protein p53 inducible nuclear protein 1

SIP, Teap, p53DINP1, TP53DINP1, TP53INP1A, TP53INP1B

94241

Q96A56

NP_150601

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit

The immunogen is a synthetic peptide directed towards the C terminal region of human TP53INP1

In response to double-strand DNA breaks, TP53INP1 promotes p53/TP53 phosphorylation on 'Ser-46' and subsequent apoptosis. TP53INP1s and HIPK2 could be partners in regulating p53 activity. TP531NP1 plays a significant role in the progression of anaplastic carcinoma or contributes to anaplastic transformation from papillary or follicular carcinoma.

ELAVL1; HIPK2; TP53; E2F4; E2F3; E2F2; E2F1

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 93%; Dog: 87%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 87%; Pig: 93%; Rabbit: 93%; Rat: 93%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

27kDa

Wet Ice

240

TP53INP1

TP53INP1

Rabbit

Tumor protein p53-inducible nuclear protein 1

NM_033285

SFRPSQWIKEHSERQPLNRNSLRRQNLTRDCHPRQVKHNGWVVHQPCPRQ