TRAPPC10 Antilichaam - C-terminal regio : HRP (ARP45766-P050-HRP)

Trafficking protein particle complex 10

EHOC1, GT334, TMEM1, TRS30, EHOC-1, TRS130

7109

Q86SI7

NP_003265.3

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish

The immunogen is a synthetic peptide directed towards the C-terminal region of human TRAPPC10

The protein encoded by this gene is a transmembrane protein found in the cis-Golgi complex. The encoded protein is part of the multisubunit transport protein particle (TRAPP) complex and may be involved in vesicular transport from the endoplasmic reticulum to the Golgi. Mutations in this gene could be responsible for the Unverricht-Lundborg type of progressive myoclonus epilepsy, or for autoimmune polyglandular disease type 1.

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 79%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

30kDa

Wet Ice

276

TRAPPC10

TRAPPC10

Rabbit

Trafficking protein particle complex subunit 10

NM_003274.4

IVDKIRNDFCNKQSDRCVVLSDPLKDSSRTQESWNAFLTKLRTLLLMSFT