TREML2 Antilichaam - middengebied: Biotine (ARP49878 P050-Biotine)

Triggering receptor expressed on myeloid cells-like 2

TLT2, TLT-2, C6orf76, dJ238O23.1

79865

Q5T2D2

NP_079083

Human, Dog

The immunogen is a synthetic peptide directed towards the middle region of human TREML2

TREML2 is a single-pass type I membrane protein, and it contains 1 Ig-like V-type (immunoglobulin-like) domain. TREML2 is a cell surface receptor that may play a role in the innate and adaptive immune response. TREML2 is located in a gene cluster on chromosome 6 with the single Ig variable (IgV) domain activating receptors TREM1 (MIM 605085) and TREM2 (MIM 605086), but it has distinct structural and functional properties (Allcock et al., 2003 [PubMed 12645956]) .[supplied by OMIM]. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1294 AY358171.1 2-1295 1295-3758 AL133404.8 7920-10383

Biotin

Polyclonal Antibody

WB

Affinity Purified

TREML2 is supported by BioGPS gene expression data to be expressed in 721_B

0.5 mg/ml

Dog: 79%; Human: 100%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

41kDa

King, R.G., (2006) J. Immunol. 176 (10), 6012-6021

Wet Ice

380

TREML2

TREML2

Rabbit

Trem-like transcript 2 protein

NM_024807

TGYSFTATSTTSQGPRRTMGSQTVTASPSNARDSSAGPESISTKSGDLST