TRIM41 Antilichaam - middelste regio : HRP (ARP34893 P050-HRP)

Tripartite motif containing 41

RINCK

90933

B3KNJ6

NP_963921

Human

The immunogen is a synthetic peptide directed towards the middle region of human TRIM41

The TRIM41 gene encodes a protein observed in the cytoplasm and the nucleus. Nuclear transport is mediated by an N-terminal segment common to both alpha and beta isoforms, but independent of a classical nuclear localization signal sequence. TRIM41 belongs to a family of tripartite motif (TRIM) proteins defined as containing a RING finger, one or more B-box domains, and a coiled-coil region (Tanaka et al., 2005 [PubMed 16022281]) . See TRIM45 (MIM 609318) .[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-84 BM457526.1 1-84 85-439 BX396615.2 116-470 440-2636 AK027601.1 456-2652 2637-2697 CA430637.1 2-62 c

ZNF264; TOP3B; NCK2; ZSCAN26; ZNF138; ZSCAN21; ZNF26; MEOX2; KIFC3; EHHADH; PHC2; CSNK2A2; CHD2; AES; MORF4L1; RNPS1; ZNF266; SORBS3; ZBTB24; KRTAP10-9; ZBTB38; FAM124A; ZNF564; ZNF417; FRA10AC1; ZNF670; TRIM41; ZNF587; PUS7L; CEP44; ZFP2; ZNF329; AEN; ZN

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Human: 100%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

59kDa

Chen, D., (2007) J. Biol. Chem. 282 (46), 33776-33787

Wet Ice

518

TRIM41

TRIM41

Rabbit

E3 ubiquitin-protein ligase TRIM41

NM_201627

RFSADCCVLGAQGFRSGRHYWEEPKEPSWPPAQPSLTYYVCPTDRPEFSF