TRMT61A Konijn pAb (APR18212N)

Catalytic subunit of tRNA (adenine-N (1--methyltransferase, which catalyzes the formation of N (1-methyladenine at position 58 (m1A58 in initiator methionyl-tRNA. Catalytic subunit of mRNA N (1-methyltransferase complex, which mediates methylation of adenosine residues at the N (1 position of a small subset of mRNAs: N (1 methylation takes place in tRNA T-loop-like structures of mRNAs and is only present at low stoichiometries.

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TRMT61A Rabbit pAb (APR18212N) .

TRMT61A; C14orf172; GCD14; Gcd14p; TRM61; hTRM61

115708

Q96FX7

Nucleus

WB 1:1000 - 1:2000 IHC 1:50 - 1:200

Liquid

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Calculated MW: 31kDa Observed MW: 33KDa

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=115708

https://www.uniprot.org/uniprot/Q96FX7

MSFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLIGRPFGSKVTCGRGGWVYVLHPTPELWTLNLPHRTQILYSTDIALITMMLELRPGSVVCESGTGSGSVSHAIIRTIAPTGHLHTVEFHQQRAEKAREEFQEHRVGRWVTVRTQDVCRSGFGVSHVADAVFLDIPSPWEAVGHAWDALKVEGGRFCSFSPCIEQVQRTCQALAARGFSELSTLEVLPQVYNVRTVSLPPPDLGTGTDGPAGSDTSPFRSGTPMKEAVGHTGYLTFATKTPG