TSR1 Antilichaam - middengebied: HRP (ARP46270_P050-HRP)

TSR1, 20S rRNA accumulation, homolog (S. cerevisiae)

FLJ10534, KIAA1401, MGC131829

55720

Q2NL82

NP_060598

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

The immunogen is a synthetic peptide directed towards the middle region of human TSR1

TSR1 belongs to the BMS1/TSR1 family and TSR1 subfamily. TSR1 is required during maturation of the 40S ribosomal subunit in the nucleolus.

UBC; TARBP2; FTSJ3; LIN28A; RPA3; RPA2; RPA1; WIBG; WDR26; PNO1; SERBP1; KIAA0368; RANBP9; RPS29; RPS28; RPS27; RPS26; RPS25; RPS24; RPS23; RPS20; RPS19; RPS18; RPS16; RPS15A; RPS14; RPS13; RPS12; RPS10; RPS9; RPS8; RPS7; RPS6; RPS5; RPS4X; RPS3A; RPS3; R

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

92kDa

Ewing, R.M., Mol. Syst. Biol. 3, 89 (2007)

Wet Ice

804

TSR1

TSR1

Rabbit

Pre-rRNA-processing protein TSR1 homolog

NM_018128

MALVATVYAPITFPPASVLLFKQKSNGMHSLIATGHLMSVDPDRMVIKRV