TUBGCP2 Rabbit pAb (APR17907N)

Gamma-tubulin complex is necessary for microtubule nucleation at the centrosome. Plays a role in neuronal migration.

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TUBGCP2 Rabbit pAb (APR17907N) .

TUBGCP2; GCP-2; GCP2; Grip103; SPBC97; Spc97p; h103p; hGCP2; hSpc97

10844

Q9BSJ2

Cytoplasm, centrosome, cytoskeleton, microtubule organizing center

WB 1:500 - 1:2000

Liquid

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Calculated MW: 88kDa/102kDa/105kDa Observed MW: 102kDa

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10844

https://www.uniprot.org/uniprot/Q9BSJ2

MSEFRIHHDVNELLSLLRVHGGDGAEVYIDLLQKNRTPYVTTTVSAHSAKVKIAEFSRTPEDFLKKYDELKSKNTRNLDPLVYLLSKLTEDKETLQYLQQNAKERAELAAAAVGSSTTSINVPAAASKISMQELEELRKQLGSVATGSTLQQSLELKRKMLRDKQNKKNSGQHLPIFPAW