TULP1 Antilichaam - middengebied: Biotine (ARP33469_P050-Biotine)

Tubby like protein 1

RP14, LCA15, TUBL1

7287

O00294

NP_003313

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast

The immunogen is a synthetic peptide directed towards the middle region of human TULP1

TULP1 is required for normal development of photoreceptor synapses. TULP1 is also required for normal photoreceptor function and for long-term survival of photoreceptor cells. TULP1 interacts with cytoskeleton proteins and may play a role in protein transport in photoreceptor cells. TULP1 binds lipids, especially phosphatidylinositol-3-phosphate, phosphatidylinositol-4-phosphate, phosphatidylinositol-5-phosphate, phosphatidylinositol-3,4-bisphosphate, phosphatidylinositol-4,5-bisphosphate, phosphatidylinositol-3,4,5-bisphosphate, phosphatidylserine and phosphatidic acid (in vitro) .This gene encodes a member of the tubby-like gene family (TULPs) . Members of this family have been identified in plants, vertebrates, and invertebrates and encode proteins of unknown function. TULP proteins share a conserved C-terminal region of approximately 200 amino acid residues. Mutations in this gene may be associated with retinitis pigmentosa. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Biotin

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 91%; Horse: 100%; Human: 100%; Mouse: 85%; Rabbit: 100%; Rat: 91%; Yeast: 100%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

60kDa

Abbasi, A.H., (er) Mol. Vis. 14, 675-682 (2008)

Wet Ice

542

TULP1

TULP1

Rabbit

Tubby-related protein 1

NM_003322

EEEEAATVIKKSNQKGKAKGKGKKKAKEERAPSPPVEVDEPREFVLRPAP