UBE2E2 Rabbit pAb (APR29971N)

Ube2E2 is an E2 enzyme, which is part of the E1, E2, and E3 cascade responsible for ubiquitination of protein substrates. It shares 96% identical amino acid sequence with Ube2E1 and Ube2E3 with the exception of the N-terminal extension that has little in common with the other two E2s. Ube2E2 interacts with ARA54 and RNF8. The RNF8/ Ube2E2 interaction is found to catalyze K48-linked poly-ubiquitination. Ube2E2 may play a role in ubiquitination and subsequent proteasomal degradation of the E3 Ub ligase Parkin.

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality UBE2E2 Rabbit pAb (APR23030N1) .

UBE2E2; UBCH8

7325

Q96LR5

WB 1:500 - 1:2000

Liquid

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Calculated MW: 22kDa Observed MW: 22KDa

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7325

https://www.uniprot.org/uniprot/Q96LR5

MSTEAQRVDDSPSTSGGSSDGDQRESVQQEPEREQVQPKKKEGKISSKTAAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT