UBE2F Konijn pAb (APR25669N)

Ube2F is an E2 enzyme, which is part of the E1, E2, and E3 cascade responsible for conjugation of Nedd8 to protein substrates. Neddylation is initiated by activating Nedd8 by the Nedd8 activating enzyme APPBP1/UBA3. Cullin is a well-known substrate for Neddylation. When NEDD8 is covalently bonded to the CRL, it stimulates its E3 Ub ligase activity. A new approach to cancer therapy involves hindering the Nedd8 conjugation pathway through inhibition of the NAE1/UBA3 enzyme.

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality UBE2F Rabbit pAb (APR25669N) .

UBE2F; NCE2

140739

Q969M7

WB (U2OS)

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Liquid

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Calculated MW: 11kDa/13kDa/17kDa/18kDa/21kDa/23kDa Observed MW: 21kDa

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=140739

https://www.uniprot.org/uniprot/Q969M7

MLTLASKLKRDDGLKGSRTAATASDSTRRVSVRDKLLVKEVAELEANLPCTCKVHFPDPNKLHCFQLTVTPDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDYIKRYAR