Uchl3 Antilichaam - middengebied: Biotine (ARP59298 P050-Biotine)

Ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase)

50933

Q9JKB1

NP_057932

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast

The immunogen is a synthetic peptide directed towards the middle region of Mouse Uchl3

Deubiquitinating enzyme (DUB) that controls levels of cellular ubiquitin through processing of ubiquitin precursors and ubiquitinated proteins. Thiol protease that recognizes and hydrolyzes a peptide bond at the C-terminal glycine of either ubiquitin or NEDD8. Uchl3 has a 10-fold preference for Arg and Lys at position P3", and exhibits a preference towards 'Lys-48'-linked Ubiquitin chains. Uchl3 deubiquitinates ENAC in apical compartments, thereby regulating apical membrane recycling. Uchl3 indirectly increases the phosphorylation of IGFIR, AKT and FOXO1 and promotes insulin-signaling and insulin-induced adipogenesis. It is required for stress-response retinal, skeletal muscle and germ cell maintenance. Uchl3 may be involved in working memory and can hydrolyze UBB (+1), a mutated form of ubiquitin which is not effectively degraded by the proteasome.

Nedd8

Biotin

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 83%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

26kDa

Wet Ice

230

UCHL3

Uchl3

Rabbit

Ubiquitin carboxyl-terminal hydrolase isozyme L3

NM_016723

IHAIANNKDKMHFESGSTLKKFLEESVSMSPEERAKFLENYDAIRVTHET