URM1 Konijn pAb (APR20382N)

Acts as a sulfur carrier required for 2-thiolation of mcm (5S (2U at tRNA wobble positions of cytosolic tRNA (Lys, tRNA (Glu and tRNA (Gln. Serves as sulfur donor in tRNA 2-thiolation reaction by being thiocarboxylated (-COSH at its C-terminus by MOCS3. The sulfur is then transferred to tRNA to form 2-thiolation of mcm (5S (2U. Also acts as a ubiquitin-like protein (UBL that is covalently conjugated via an isopeptide bond to lysine residues of target proteins such as MOCS3, ATPBD3, CTU2, USP15 and CAS. The thiocarboxylated form serves as substrate for conjugation and oxidative stress specifically induces the formation of UBL-protein conjugates.

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality URM1 Rabbit pAb (APR20382N) .

URM1; C9orf74

81605

Q9BTM9

Cytoplasm

WB 1:500 - 1:2000 IF 1:50 - 1:100

Liquid

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Calculated MW: 7kDa/11kDa/15kDa Observed MW: 11kDa

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=81605

https://www.uniprot.org/uniprot/Q9BTM9

MAAPLSVEVEFGGGAELLFDGIKKHRVTLPGQEEPWDIRNLLIWIKKNLLKERPELFIQGDSV