Vamp7 Antilichaam - C-terminal regio: FITC (ARP47593_P050-FITC)

Vesicle-associated membrane protein 7

Syb, VAM, Sybl1, VAMP-7, TI-VAMP

20955

P70280

NP_035645

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish

Vamp7 is involved in the targeting and/or fusion of transport vesicles to their target membrane during transport of proteins from the early endosome to the lysosome. Vamp7 is required for heterotypic fusion of late endosomes with lysosomes and homotypic lysosomal fusion.Vamp7 is required for calcium regulated lysosomal exocytosis. Vamp7 is involved in the export of chylomicrons from the endoplasmic reticulum to the cis Golgi.Vamp7 is required for exocytosis of mediators during eosinophil and neutrophil degranulation, and target cell killing by natural killer cells. Vamp7 is also required for focal exocytosis of late endocytic vesicles during phagosome formation.

Stx7

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

25kDa

Wet Ice

220

VAMP7

Vamp7

Rabbit

Vesicle-associated membrane protein 7

NM_011515

DELKGIMVRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLARAMC