VEGFC HEK Recombinant eiwit

Source : HEK293 cells. VEGFC Human Recombinant produced by transfected human cells is a single polypeptide chain containing 204 amino acids (32-227) . VEGFC is fused to an 8 amino acid His-tag at C-terminus & purified by proprietary chromatographic techniques. VEGF-C, also known as Vascular Endothelial Growth Factor Related Protein (VRP), is a recently discovered VEGF growth factor family member that is most closely related to VEGF-D. Human VEGF-C cDNA encodes a pre-pro-protein of 416 amino acids residues. It is almost identical to the mouse VEGF-C protein. Similar to VEGF-D, VEGF-C has a VEGF homology domain spanning the middle third of the precursor molecule and long N- and C-terminal extensions. In adults, VEGF-C is highly expressed in heart, placenta, ovary and small intestine. Recombinant human VEGF-C, lacking the N- and C-terminal extensions and containing only the middle VEGF homology domain, forms primarily non-covalently linked dimers. This protein is a ligand for both VEGFR-2/KDR and VEGFR-3/FLT-4. Since VEGFR-3 is strongly expressed in lymphatic endothelial cells, it has been postulated that VEGF-C is involved in the regulation of the growth and/or differentiation of lymphatic endothelium. Although recombinant human VEGF-C is also a mitogen for vascular endothelial cells, it is much less potent than VEGF-A.

VEGF-C||Vascular endothelial growth factor C||VRP||Flt4 ligand||Flt4-L||Vascular endothelial growth factor-related protein||VEGFC.

Greater than 95% as determined by SDS-PAGE.

VEGFC was lyophilized from a 0.2 mM filtered solution of 20mM Tris-HCl and 150mM NaCl, pH 7.2.

Lyophilized VEGFC although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution VEGFC should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.

It is recommended to reconstitute the lyophilized VEGFC in 1xPBS to a concentration no less than 100 μg/ml, which can then be further diluted to other aqueous solutions.

FESGLDLSDAEPDAGEATAYASKDLEEQLRSVSSVDELMTVLYPEYWKMYKCQLRKGGWQHNREQANLNSRTEETIKFAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRRVDHHHHHH.