
VEGI Recombinant eiwit
Kwaliteit
ISO Gecertificeerd
Levering
24-48 uur
Technische Specificaties
Source : Escherichia Coli. TNFSF15 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 180 amino acids and having a molecular mass of 20.5kDa. The TNFSF15 is purified by proprietary chromatographic techniques. TNFSF15 is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is abundantly expressed in endothelial cells, but is not expressed in either B or T cells. The expression of TNFSF15 is inducible by TNF and IL-1 alpha. This cytokine is a ligand for receptor TNFRSF25 and decoy receptor TNFRSF21/DR6. It can activate NF-kappaB and MAP kinases, and acts as an autocrine factor to induce apoptosis in endothelial cells. TNFSF15 is also found to inhibit endothelial cell proliferation, and thus may function as an angiogenesis inhibitor. An additional isoform encoded by an alternatively spliced transcript variant has been reported but the sequence of this transcript has not been determined.
Tumor necrosis factor ligand superfamily member 15||TNFSF-15||TNFSF15||TNF ligand-related molecule 1||VEGI||TL-1||TL1||TL1A||VEGI192A||VEGI-192||MGC129934||MGC129935.
Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
The TNFSF15 was lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4 with 0.02% Tween-20.
TNFSF15 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution VEGI should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles.
It is recommended to reconstitute the lyophilized TNFSF15 in sterile 18MΩ-cm H2O not less than 100 μg/ml, which can then be further diluted to other aqueous solutions. The ED50 as determined by its ability to induce apoptosis using human TF-1 cells is less than 20ng/ml, corresponding to a specific activity of > 5.0ƒâ€”104 IU/mg.
MQLTKGRLHFSHPLSHTKHISPFVTDAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL.
Beschrijving
Source : Escherichia Coli. TNFSF15 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 180 amino acids and having a
Specificaties
Recent bekeken producten

Anti- Protein A Antibody
GWB-E66F30
1 mL

Recombinant TAFV GP1 Protein, C-Fc
EVV03609
100 μg

Gabbr1 Mouse Monoclonal Antibody [Clone ID: S93A-49]
TA326530
100 µg

BSA-Myc/DDK Control Protein
AR100025
50 µL

NH-6
ABC-TC0826
1 Vial

Anti-TAT (Thrombin-antithrombin) Antibody
ABS 014-22-1
1000 µL

Anti-APOE2 mouse monoclonal antibody
TD-AB0132
100 µg

CD35 (CR1) mouse monoclonal antibody, clone J3D3, Azide Free
BM2364
0.2 mg
Recent gezochte producten

LBA4404 Agrobacterium ElectroCompetent Cells
1285-20
10x 50 µL

ATCC15834 Agrobacterium ElectroCompetent Cells
1275-36
18x 50 µL

Ar.A4 Agrobacterium ElectroCompetent Cells
1272-12
6x 50 µL

AGL1 Agrobacterium ElectroCompetent Cells
1283-12
6x 50 µL

K599 Agrobacterium ElectroCompetent Cells
1287-12
6x 50 µL

AGL1 Agrobacterium ElectroCompetent Cells
1283-20
10x 50 µL

Ar.A4 Agrobacterium ElectroCompetent Cells
1272-36
18x 50 µL

AGL1 Agrobacterium ElectroCompetent Cells
1283-36
18x 50 µL
