Wnt1 Antilichaam - C-terminaal gebied: Biotine (ARP32123_P050-Biotine)

Wingless-type MMTV integration site family, member 1

Sw, Int, Wnt-, Int-1, Wnt-1, swaying

22408

P04426

NP_067254

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

The immunogen is a synthetic peptide directed towards the C-terminal region of MOUSE Wnt1

Wnt1 is a ligand for members of the frizzled family of seven transmembrane receptors. In some developmental processes, it is also a ligand for the coreceptor RYK, thus triggering Wnt signaling. It is a probable developmental protein and may be a signaling molecule important in CNS development. Wnt1 is likely to signal over only few cell diameters. It ha s a proeminent role in the induction of the mesencephalon and cerebellum. It may play a crucial role in the morphogenesis of the neural tube and/or the early stages of CNS development. It has a role in osteoblast function and bone development.

Lrp6-b; Lrp6; Wnt3a; Porcn; Ryk; Lrp5; Fzd8; Fzd1; Dkk1

Biotin

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

40kDa

Wet Ice

370

WNT1

Wnt1

Rabbit

Proto-oncogene Wnt-1

NM_021279

NFCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCN