WNT5A Antilichaam - middengebied: FITC (ARP32128_P050-FITC)

Wingless-type MMTV integration site family, member 5A

HWNT5A

7474

P41221

NP_003383

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

The immunogen is a synthetic peptide directed towards the middle region of human WNT5A

The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. WNT5A is a member of the WNT protein family. It shows 98%, 98% and 87% amino acid identity to the mouse, rat and the xenopus Wnt5A protein, respectively. The experiments performed in Xenopus laevis embryos identified that human frizzled-5 (hFz5) is the receptor for the Wnt5A ligand and the Wnt5A/hFz5 signaling mediates axis induction.The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It encodes a protein which shows 98%, 98% and 87% amino acid identity to the mouse, rat and the xenopus Wnt5A protein, respectively. The experiments performed in Xenopus laevis embryos identified that human frizzled-5 (hFz5) is the receptor for the Wnt5A ligand and the Wnt5A/hFz5 signaling mediates axis induction. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

UBC; LRP6; FZD2; FZD1; ROR2; FZD5

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB, IHC

Affinity Purified

WNT5A is strongly supported by BioGPS gene expression data to be expressed in HeLa

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 87%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 80%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

42kDa

Witze, E.S., (2008) Science 320 (5874), 365-369

Wet Ice

380

WNT5A

WNT5A

Rabbit

Protein Wnt-5a

NM_003392

GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT