WNT6 Antilichaam - middengebied: FITC (ARP46733_P050-FITC)

Wingless-type MMTV integration site family, member 6

7475

Q9Y6F9

NP_006513

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit

The immunogen is a synthetic peptide directed towards the middle region of human WNT6

The WNT family consists of several secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. WNT6 is overexpressed in cervical cancer cell line and strongly coexpressed with another family member, WNT10A, in colorectal cancer cell line. The WNT6 protein overexpression may play key roles in carcinogenesis. The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It is overexpressed in cervical cancer cell line and strongly coexpressed with another family member, WNT10A, in colorectal cancer cell line. The gene overexpression may play key roles in carcinogenesis. This gene and the WNT10A gene are clustered in the chromosome 2q35 region. The protein encoded by this gene is 97% identical to the mouse Wnt6 protein at the amino acid level.

PORCN

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

Affinity Purified

WNT6 is supported by BioGPS gene expression data to be expressed in HEK293T

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

37kDa

Adaimy, L., (2007) Am. J. Hum. Genet. 81 (4), 821-828

Wet Ice

365

WNT6

WNT6

Rabbit

Protein Wnt-6

NM_006522

ERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTG