ZBTB48 Antilichaam - middengebied HRP (ARP58014_P050-HRP)

Zinc finger and BTB domain containing 48

HKR3, TZAP, ZNF855, pp9964

3104

P10074

NP_005332

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

The immunogen is a synthetic peptide directed towards the middle region of human ZBTB48

ZBTB48 contains 1 BTB (POZ) domain and 11 C2H2-type zinc fingers. It belongs to the krueppel C2H2-type zinc-finger protein family and binds to and regulates the J and/or S elements in MHC II promoter.

ZBTB8A; KRTAP10-5; GPATCH2L; NME7; ZBTB48; ZBTB7A; EP300; UPF2; CDK2AP2; TNFRSF14; RGS2; ILK; CDKN1A; PNRC2; NUDT21; C11orf58; C7orf34; ZBTB8B; DVL3

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

77kDa

Maris, J.M., (1997) Eur. J. Cancer 33 (12), 1991-1996

Wet Ice

688

ZBTB48

ZBTB48

Rabbit

Zinc finger and BTB domain-containing protein 48

NM_005341

EFCSHAFTQKANLNMHLRTHTGEKPFQCHLCGKTFRTQASLDKHNRTHTG