ZDHC16 Rabbit pAb (APR27220N)

Palmitoyl acyltransferase that mediates palmitoylation of proteins such as PLN and ZDHHC6. Required during embryonic heart development and cardiac function, possibly by mediating palmitoylation of PLN, thereby affecting PLN phosphorylation and homooligomerization (By similarity. Also required for eye development (By similarity. Palmitoylates ZDHHC6, affecting the quaternary assembly of ZDHHC6, its localization, stability and function. May play a role in DNA damage response (By similarity. May be involved in apoptosis regulation (By similarity. Involved in the proliferation of neural stem cells by regulating the FGF/ERK pathway (By similarity.

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ZDHHC16 Rabbit pAb (APR27220N) .

ZDHHC16; APH2; DHHC-16

84287

Q969W1

Endoplasmic reticulum membrane, Multi-pass membrane protein

WB 1:500 - 1:2000

Liquid

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Calculated MW: 34kDa/38kDa/41kDa/43kDa Observed MW: 44kDa

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=84287

https://www.uniprot.org/uniprot/Q969W1

HAVLISRGETSIERHINKKERRRLQAKGRVFRNPYNYGCLDNWKVFLGVDTGRHWLTRVLLPSSHLPHGNGMSWEPPPWVTAHSASVMAV