ZNF212 Antilichaam - C-terminalgebied: FITC (ARP33602_T100-FITC)

Zinc finger protein 212

ZNF182, ZNFC150, C2H2-150

7988

Q9UDV6

NP_036388

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit

The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF212

ZNF212 belongs to the C2H2-type zinc finger gene family. The zinc finger proteins are involved in gene regulation and development, and are quite conserved throughout evolution. Like this gene product, a third of the zinc finger proteins containing C2H2 fingers also contain the KRAB domain, which has been found to be involved in protein-protein interactions.

LOC155060; FAM90A1; SF3A3; SUV39H2; NKX2-3; ZNF408; CREB3L2; ZNF331; SAP30BP; RND1; HBP1; ZNF212; PTP4A1; ZNF3; DPF2; NFKBIA; GNL1; FHL2; DUSP6; CSK; ATF4; ATF3; PPARGC1B; ZZZ3

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

0.5 mg/ml

Cow: 79%; Dog: 90%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 83%; Pig: 92%; Rabbit: 85%; Rat: 83%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

55kDa

Scherer, S.W., et al., (2003) Science 300 (5620), 767-772

Wet Ice

495

ZNF212

ZNF212

Rabbit

Zinc finger protein 212

NM_012256

EGPSAGQHVQERFSPNSLVALPGHIPWRKSRSSLICGYCGKSFSHPSDLV